PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Eucgr.C00348.2.p
Common NameEUGRSUZ_C00348
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Myrtales; Myrtaceae; Myrtoideae; Eucalypteae; Eucalyptus
Family WRKY
Protein Properties Length: 465aa    MW: 50554.7 Da    PI: 10.7832
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Eucgr.C00348.2.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY74.61.2e-23153208359
                       -SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   3 DgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                       DgynWrKYGqK+vk+ + +rsY+rCt ++C++kk +e+s+   +++e++Y+++Hnh+
  Eucgr.C00348.2.p 153 DGYNWRKYGQKQVKSPKGSRSYFRCTNSDCSAKK-IECSDLLSQTTETVYRSSHNHD 208
                       9*******************************98.*********************7 PP

2WRKY98.44.6e-31326383259
                       --SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
              WRKY   2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                        Dgy+WrKYGqK+vkg+++pr+YYrCtsagCpv+k+ve++ ++ ++v+itY+g H+h+
  Eucgr.C00348.2.p 326 ADGYRWRKYGQKMVKGNPYPRNYYRCTSAGCPVRKQVETALDNASAVTITYKGIHDHD 383
                       6********************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5081117.844146210IPR003657WRKY domain
Gene3DG3DSA:2.20.25.806.6E-19149210IPR003657WRKY domain
SMARTSM007746.5E-22151209IPR003657WRKY domain
SuperFamilySSF1182907.72E-18152210IPR003657WRKY domain
PfamPF031061.4E-17153208IPR003657WRKY domain
Gene3DG3DSA:2.20.25.808.8E-32310385IPR003657WRKY domain
PROSITE profilePS5081130.572320385IPR003657WRKY domain
SuperFamilySSF1182904.58E-27321385IPR003657WRKY domain
SMARTSM007741.1E-35325384IPR003657WRKY domain
PfamPF031062.5E-24327382IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 465 aa     Download sequence    Send to blast
MPSRPTTRRR RSRSRSPRRS ASATCRSSAS PGSASPADPR WRRRRGAAAG GWRRRACARV  60
ERANQLNGEL GSDITGEAAE TYSRNPRTVC PSISSGLLLV SVSQSISSVA SSTPLDRKLP  120
PTTKVTDSCT VRSKVRNSSD CGTTSAVKAS GGDGYNWRKY GQKQVKSPKG SRSYFRCTNS  180
DCSAKKIECS DLLSQTTETV YRSSHNHDPP QKVRDGRQRS RVKSSRIIVE SEVAKHPVRM  240
LPESDPSVAS REQKNELPSS VPGREIQEAN GFDANYGIVA KQGNDNDPEL KPRGKKNRLI  300
RSSSPLKPGK KPKFVVHAAG DVGISADGYR WRKYGQKMVK GNPYPRNYYR CTSAGCPVRK  360
QVETALDNAS AVTITYKGIH DHDRPVPKKR NGPPSVPLIA AASSDSLHST PIKKSDGLRD  420
HTSPTQCSVD SEGELSSQAL DLGGEKAIES ARTLLSIGFE IKPR*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ayd_A2e-23313385274WRKY transcription factor 1
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapEucgr.C00348.2.p
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010047108.10.0PREDICTED: probable WRKY transcription factor 32
SwissprotP595831e-102WRK32_ARATH; Probable WRKY transcription factor 32
TrEMBLA0A059CKZ00.0A0A059CKZ0_EUCGR; Uncharacterized protein
STRINGVIT_11s0037g00150.t011e-134(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G30935.18e-98WRKY DNA-binding protein 32